GTF3C2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GTF3C2 |
GTF3C2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GTF3C2 |
GTF3C2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GTF3C2 |
GTF3C2 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 60-112 of Human TFIIIC110. |
GTF3C2 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 140-170 amino acids from the N-terminal region of Human GTF3C2 / TFIIIC110 |
Rabbit Polyclonal Anti-GTF3C2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GTF3C2 antibody: synthetic peptide directed towards the middle region of human GTF3C2. Synthetic peptide located within the following region: YKADLIPYQDSPEGPDHSSASSGVPNPPKARTYTETVNHHYLLFQDTDLG |