Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Fascin/FSCN1 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 394-493 of human Fascin/Fascin/FSCN1 (NP_003079.1). |
| Modifications | Unmodified |
Fascin Rabbit polyclonal Antibody
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human Fascin |
Fascin Mouse Monoclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Fascin (FSCN1) goat polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence RDTKKCAFRTHT, from the internal region of the protein sequence according to NP_003079.1. |
Rabbit Polyclonal Anti-Fscn1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Fscn1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VVAHDDGRWSLQSEAHRRYFGGTEDRLSCFAQSVSPAEKWSVHIAMHPQV |
Fascin/FSCN1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 260-380 of human Fascin/Fascin/FSCN1 (NP_003079.1). |
| Modifications | Unmodified |
Fascin (FSCN1) pSer39 rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Nter domain of human FSCN1 containing phosphorserine at position 39 |
Recombinant Anti-FSCN1 (Clone SAIC-32C-205)
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-Fascin (clone 55K2) Antibody
| Applications | ICC, IHC, WB |
| Reactivities | Human, Rat, Mouse |
| Conjugation | Unconjugated |
Anti-Fascin (Ser-39), Phosphospecific Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat, Mouse, Chicken |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- FSCN1