Antibodies

View as table Download

EDEM1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human EDEM1

Rabbit Polyclonal Anti-EDEM1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EDEM1 antibody: synthetic peptide directed towards the N terminal of human EDEM1. Synthetic peptide located within the following region: MAHAFPQDELNPIHCRGRGPDRGDPSNLNINDVLGNYSLTLVDALDTLAI