Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Antibody against DDX5 / p68 RNA helicase
| Applications | IHC, WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PMIGYPMPTGYSQ, from the C Terminus of the protein sequence according to NP_004387.1. |
DDX5 Rabbit polyclonal Antibody
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human DDX5 |
DDX5 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from 306-334 aa at the Center region of human DDX5 |
DDX5 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-614 of human DDX5 (NP_004387.1). |
| Modifications | Unmodified |
DDX5 (C-term) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of human DDX5. |
Rabbit anti-DDX5 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human DDX5 |
Rabbit Polyclonal Anti-DDX5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDX5 antibody: synthetic peptide directed towards the C terminal of human DDX5. Synthetic peptide located within the following region: SFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAY |
Rabbit Polyclonal Anti-DDX5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDX5 antibody: synthetic peptide directed towards the N terminal of human DDX5. Synthetic peptide located within the following region: RGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFY |
p68 RNA Helicase (phospho-Y593) polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from human p68 RNA Helicase around the phosphorylation site of Y593. |
Active filters
Target Symbol
- DDX5