Rabbit polyclonal DKC1 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This DKC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 185-213 amino acids from the Central region of human DKC1. |
DKC1 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, corresponding to amino acids 171-220 of Human Dyskerin. |
Goat Anti-DKC1 Antibody
| Applications | IHC |
| Reactivities | Human (Expected from sequence similarity: Mouse) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KRKRESESESDETPP, from the internal region of the protein sequence according to NP_001354.1. |
Rabbit Polyclonal Anti-DKC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DKC1 antibody: synthetic peptide directed towards the N terminal of human DKC1. Synthetic peptide located within the following region: EFLIKPESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACGSNPLKREIG |
Rabbit Polyclonal Anti-Dyskerin Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Dyskerin Antibody: A synthesized peptide derived from human Dyskerin |
DKC1 Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse DKC1 |
Germany
Japan
United Kingdom
China
