Germany
Japan
United Kingdom
China
Rabbit Polyclonal CHCHD6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal CHCHD6 antibody was raised against a 17 amino acid peptide near the amino terminus of human CHCHD6. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-CHCHD6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHCHD6 antibody: synthetic peptide directed towards the N terminal of human CHCHD6. Synthetic peptide located within the following region: LPRSGSSGGQQPSGMKEGVKRYEQEHAAIQDKLFQVAKREREAATKHSKA |
Rabbit Polyclonal Anti-CHCHD6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHCHD6 antibody: synthetic peptide directed towards the middle region of human CHCHD6. Synthetic peptide located within the following region: AAIQDKLFQVAKREREAATKHSKASLPTGEGSISHEEQKSVRLARELESR |
CHCHD6 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-235 of human CHCHD6 (NP_115719.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CHCHD6