Antibodies

Jump to Filters
View as table Download
CEACAM6 Mouse Monoclonal Antibody [Clone ID: 9A6]
AM02001PU-N

USD 490.00

2 Weeks

CEACAM6 mouse monoclonal antibody, clone 9A6, Purified

Applications ELISA, FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
CEACAM6 Mouse Monoclonal Antibody [Clone ID: OTI5A10]
TA809254

USD 447.00

In Stock

CEACAM6 mouse monoclonal antibody,clone OTI5A10

Applications IHC
Reactivities Human
Conjugation Unconjugated
CEACAM6 Mouse Monoclonal Antibody [Clone ID: OTI5A10]
CF809254

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) CEACAM6 mouse monoclonal antibody,clone OTI5A10

Applications IHC
Reactivities Human
Conjugation Unconjugated
CEACAM6 Rabbit Polyclonal Antibody
TA350819

USD 380.00

In Stock

Rabbit Polyclonal Anti-CEACAM6 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CEACAM6
CEACAM6 Rabbit Polyclonal Antibody
TA366861

USD 380.00

4 Weeks

CEACAM6 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CEACAM6
CEACAM6 Rabbit Polyclonal Antibody
TA346090

USD 485.00

5 Days

Rabbit Polyclonal Anti-CEACAM6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CEACAM6 antibody: synthetic peptide directed towards the middle region of human CEACAM6. Synthetic peptide located within the following region: EIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNP
CEACAM6 Mouse Monoclonal Antibody [Clone ID: OTI5A10]
TA809254S

USD 200.00

2 Days

CEACAM6 mouse monoclonal antibody,clone OTI5A10

Applications IHC
Reactivities Human
Conjugation Unconjugated
CEACAM6 Rabbit Polyclonal Antibody
TA346089

USD 539.00

5 Days

Rabbit Polyclonal Anti-CEACAM6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CEACAM6 antibody: synthetic peptide directed towards the N terminal of human CEACAM6. Synthetic peptide located within the following region: KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVI
Anti-CEACAM6 antibody(DMC685), IgG1 Chimeric mAb
TA389595

USD 595.00

4 Weeks

Anti-CEACAM6 antibody(DMC685), IgG1 Chimeric mAb

Applications FC
Reactivities Human
Conjugation Unconjugated