Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-Adam22 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Adam22 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AISENPLITLREFMKYRRDFIKEKADAVHLFSGSQFESSRSGAAYIGGIC |
ADAM22 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 223-400 of human ADAM22 (NP_004185.1). |
| Modifications | Unmodified |
ADAM22 rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from C-terminal domain of the Human ADAM22 protein. |
Active filters
Target Symbol
- ADAM22