Antibodies

View as table Download

Rabbit polyclonal anti-ACRBP antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ACRBP.

Rabbit Polyclonal Anti-ACRBP Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACRBP antibody is: synthetic peptide directed towards the N-terminal region of Human ACRBP. Synthetic peptide located within the following region: KVLLLPLAPAAAQDSTQASTPGSPLSPTEYERFFALLTPTWKAETTCRLR