PAPSS2 mouse monoclonal antibody, clone OTI3H10 (formerly 3H10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PAPSS2 mouse monoclonal antibody, clone OTI3H10 (formerly 3H10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PAPSS2 mouse monoclonal antibody,clone OTI6H10
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PAPSS2 mouse monoclonal antibody, clone OTI3H10 (formerly 3H10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PAPSS2 mouse monoclonal antibody,clone OTI6H10
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
PAPSS2 mouse monoclonal antibody, clone OTI3H10 (formerly 3H10), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PAPSS2 mouse monoclonal antibody, clone OTI3H10 (formerly 3H10), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 509.00
2 Weeks
PAPSS2 mouse monoclonal antibody,clone OTI6H10, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PAPSS2 mouse monoclonal antibody,clone OTI6H10, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PAPSS2 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PAPSS2 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
PAPSS2 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PAPSS2 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Rabbit Polyclonal Anti-CBS Antibody
Applications | IHC, WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CBS antibody: synthetic peptide directed towards the N terminal of human CBS. Synthetic peptide located within the following region: RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE |
PAPSS2 mouse monoclonal antibody, clone OTI5H3 (formerly 5H3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PAPSS2 mouse monoclonal antibody, clone OTI1E12 (formerly 1E12)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |