Antibodies

View as table Download

Rabbit polyclonal anti-PA2G6 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human PA2G6.

Goat Anti-PLA2G4A Antibody

Applications WB
Reactivities Human, Mouse (Expected from sequence similarity: Rat)
Conjugation Unconjugated
Immunogen Peptide with sequence C-QEKTFRQQRKEHIR, from the internal region of the protein sequence according to NP_077734.1.

Rabbit Polyclonal c-PLA2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human c-PLA2

Rabbit Polyclonal c-PLA2 (Ser505) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human c-PLA2 around the phosphorylation site of Serine 505
Modifications Phospho-specific

Rabbit polyclonal antibody to Phospholipase A2 XIIA (phospholipase A2, group XIIA)

Applications WB
Reactivities Human (Predicted: Rat, Bovine, Rhesus Monkey, Mouse)
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 22 and 115 of PLA2G12A (Uniprot ID#Q9BZM1)

Rabbit Polyclonal Anti-ACOX3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ACOX3 antibody: synthetic peptide directed towards the C terminal of human ACOX3. Synthetic peptide located within the following region: SWTTQQGIQECREACGGHGYLAMNRLGVLRDDNDPNCTYEGDNNILLQQT