Antibodies

View as table Download

MYL9 mouse monoclonal antibody,clone OTI3H6

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MYL9 mouse monoclonal antibody,clone OTI3H6

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-MYL9 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 2-14 amino acids of Human myosin, light chain 9, regulatory

Anti-MYL9 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 2-14 amino acids of Human myosin, light chain 9, regulatory

MYL9 mouse monoclonal antibody,clone OTI3H6, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

MYL9 mouse monoclonal antibody,clone OTI3H6, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

MYL9 mouse monoclonal antibody,clone OTI3H6

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-MYL9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MYL9 antibody: synthetic peptide directed towards the middle region of human MYL9. Synthetic peptide located within the following region: FDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEF

MYL9 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 95-125aa) of human MYL9