Rabbit Polyclonal Anti-FST Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human FST |
Rabbit Polyclonal Anti-FST Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human FST |
Rabbit polyclonal anti-FST antibody
Applications | WB |
Reactivities | Mouse, Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FST. |
Rabbit Polyclonal Anti-FST Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FST antibody: synthetic peptide directed towards the middle region of human FST. Synthetic peptide located within the following region: ALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCN |
Rabbit Polyclonal Anti-FST Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FST antibody: synthetic peptide directed towards the C terminal of human FST. Synthetic peptide located within the following region: SLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCN |