ACTN3 (N-term) rabbit polyclonal antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ACTN3 antibody was raised against synthetic peptide - KLH conjugated |
ACTN3 (N-term) rabbit polyclonal antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ACTN3 antibody was raised against synthetic peptide - KLH conjugated |
ACTN3 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 408-437 amino acids from the Central region of human ACTN3 |
Rabbit polyclonal anti-ACTN3 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human ACTN3. |
Anti-ACTN3 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 3-261 amino acids of human actinin, alpha 3 |
Anti-ACTN3 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 3-261 amino acids of human actinin, alpha 3 |
Rabbit Polyclonal Anti-ACTN3 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACTN3 antibody: synthetic peptide directed towards the N terminal of human ACTN3. Synthetic peptide located within the following region: VQNFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKY |