Rabbit Polyclonal Anti-GLO1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GLO1 |
Rabbit Polyclonal Anti-GLO1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GLO1 |
Rabbit Polyclonal antibody to Glyoxalase I (glyoxalase I)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse (Predicted: Rat, Xenopus, Bovine, X. tropicalis) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 184 of Glyoxalase I (Uniprot ID#Q04760) |
Mouse Monoclonal GLO1 Antibody (Glo1a)
Applications | ELISA, ICC/IF, IHC, IP, Simple Western, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti-GLO1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GLO1 |
Rabbit Polyclonal Anti-GLO1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GLO1 antibody: synthetic peptide directed towards the N terminal of human GLO1. Synthetic peptide located within the following region: TMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKE |
GLO1 (N-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human GLO1 |