Goat Polyclonal CREB3 (aa76-87) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HHDHTYSLPRET, from the internal region of the protein sequence according to NP_006359.3 |
Goat Polyclonal CREB3 (aa76-87) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HHDHTYSLPRET, from the internal region of the protein sequence according to NP_006359.3 |
Rabbit Polyclonal Anti-CREB3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CREB3 antibody: synthetic peptide directed towards the middle region of human CREB3. Synthetic peptide located within the following region: SRVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSST |
Rabbit Polyclonal Anti-CREB3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CREB3 antibody: synthetic peptide directed towards the C terminal of human CREB3. Synthetic peptide located within the following region: YSSDTRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLD |
Rabbit Polyclonal Anti-CREB3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CREB3 antibody: synthetic peptide directed towards the middle region of human CREB3. Synthetic peptide located within the following region: PPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG |