Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Anti-NMDA NR2B Subunit Antibody
| Applications | WB |
| Reactivities | Rat, Mouse, Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein from the C-terminal region of the NR2B subunit |
Rabbit Polyclonal Anti-UCRC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UCRC antibody: synthetic peptide directed towards the middle region of human UCRC. Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK |
BAX (3-16) mouse monoclonal antibody, clone 2D2, Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
BAX (3-16) mouse monoclonal antibody, clone 2D2, Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
Rabbit polyclonal anti-NDUFA4L2 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUFA4L2. |
NMDAR1 / NR1 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | GRIN1 / NMDAR1 antibody was raised against synthetic peptide from human NMDAR1 (aa864-913). |
Active filters
Families
- Transmembrane
Pathways
- Huntington's disease
Citations
- Yes