Rabbit Polyclonal Anti-STAG2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human STAG2 |
Rabbit Polyclonal Anti-STAG2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human STAG2 |
SA2 (STAG2) goat polyclonal antibody, Aff - Purified
Applications | ELISA, WB |
Reactivities | Bovine, Canine, Human, Mouse, Porcine, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SRGSTVRSKKSKPST, from the internal region of the protein sequence according to NP_001036214.1; NP_006594.3. |
Goat Polyclonal Antibody against STAG2
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-REPKRLRPEDS, from the internal region of the protein sequence according to NP_001036214.1; NP_001036215.1 ; NP_001036216.1 ; NP_006594.3. |
Rabbit Polyclonal Anti-STAG2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-STAG2 antibody is: synthetic peptide directed towards the C-terminal region of Human STAG2. Synthetic peptide located within the following region: LLAGGDDDTMSVISGISSRGSTVRSKKSKPSTGKRKVVEGMQLSLTEESS |
STAG2 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human STAG2 |
STAG2 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human STAG2 |