Rabbit Polyclonal Anti-SLIT3 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SLIT3 |
Rabbit Polyclonal Anti-SLIT3 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SLIT3 |
Rabbit Polyclonal Anti-SLIT3 Antibody - N-terminal region
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SLIT3 antibody: synthetic peptide directed towards the N terminal of human SLIT3. Synthetic peptide located within the following region: PRRLANKRISQIKSKKFRCSGSEDYRSRFSSECFMDLVCPEKCRCEGTIV |