Germany
Japan
United Kingdom
China
USD 509.00
2 Weeks
TNFRSF18 mouse monoclonal antibody, clone OTI1C4 (formerly 1C4), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
Antibodies
View as table Download
Rabbit Polyclonal Anti-TNFRSF18 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TNFRSF18 antibody: synthetic peptide directed towards the C terminal of human TNFRSF18. Synthetic peptide located within the following region: LRSQCMWPRETQLLLEVPPSTEDARSCQFPEEERGERSAEEKGRLGDLWV |
Rabbit Polyclonal Anti-TNFRSF18 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TNFRSF18 antibody: synthetic peptide directed towards the C terminal of human TNFRSF18. Synthetic peptide located within the following region: LHIWQLRKTQLLLEVPPSTEDARSCQFPEEERGERSAEEKGRLGDLWV |
TNFRSF18 mouse monoclonal antibody, clone OTI3A7 (formerly 3A7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TNFRSF18 mouse monoclonal antibody, clone OTI5G4 (formerly 5G4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TNFRSF18 mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- TNFRSF18
Reactivities
- Human
Pathways
- Cytokine-cytokine receptor interaction