SORBS2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SORBS2 |
SORBS2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SORBS2 |
Rabbit polyclonal ARGBP2 Antibody (N-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human (Predicted: Mouse, Rat, Pig) |
Conjugation | Unconjugated |
Immunogen | This ARGBP2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 175-204 amino acids from the N-terminal region of human ARGBP2. |
SORBS2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SORBS2 |
Rabbit Polyclonal Anti-SORBS2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SORBS2 antibody is: synthetic peptide directed towards the middle region of Human SORBS2. Synthetic peptide located within the following region: LRPRDRSSTEKHDWDPPDRKVDTRKFRSEPRSIFEYEPGKSSILQHERPA |