Antibodies

View as table Download

SORBS2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human SORBS2

Rabbit polyclonal ARGBP2 Antibody (N-term)

Applications FC, IF, IHC, WB
Reactivities Human (Predicted: Mouse, Rat, Pig)
Conjugation Unconjugated
Immunogen This ARGBP2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 175-204 amino acids from the N-terminal region of human ARGBP2.

SORBS2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human SORBS2

Rabbit Polyclonal Anti-SORBS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SORBS2 antibody is: synthetic peptide directed towards the middle region of Human SORBS2. Synthetic peptide located within the following region: LRPRDRSSTEKHDWDPPDRKVDTRKFRSEPRSIFEYEPGKSSILQHERPA