Antibodies

Jump to Filters
View as table Download
Pellino 1 (PELI1) Rabbit Polyclonal Antibody
TA326634

USD 570.00

5 Days

Rabbit Polyclonal Pellino 1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit polyclonal Pellino 1 antibody was raised against a 15 amino acid peptide near the carboxy terminus of human Pellino 1.
Pellino 1 (PELI1) Rabbit Polyclonal Antibody
TA344773

USD 539.00

5 Days

Rabbit Polyclonal Anti-PELI1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PELI1 antibody: synthetic peptide directed towards the N terminal of human PELI1. Synthetic peptide located within the following region: ESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACRIICERNPPFTARIYAA