Antibodies

Jump to Filters
View as table Download
PDCD2 Rabbit Polyclonal Antibody
TA322984

USD 380.00

In Stock

Anti-PDCD2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 330-344 amino acids of Human programmed cell death 2
PDCD2 Rabbit Polyclonal Antibody
TA322983

USD 380.00

In Stock

Anti-PDCD2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 330-344 amino acids of Human programmed cell death 2
Pdcd2 Rabbit Polyclonal Antibody
TA329160

USD 539.00

5 Days

Rabbit Polyclonal anti-Pdcd2 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Pdcd2 antibody is: synthetic peptide directed towards the middle region of Rat Pdcd2. Synthetic peptide located within the following region: AGLRVFRNQLPRKNAFYSYEPPSETGASDTECVCLQLKSGAHLCRVCGCL
PDCD2 Rabbit Polyclonal Antibody
TA379715

USD 365.00

3 Weeks

PDCD2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-344 of human PDCD2 (NP_002589.2).
Modifications Unmodified