Antibodies

Jump to Filters
View as table Download
Coatomer subunit delta (ARCN1) Rabbit Polyclonal Antibody
TA308389

USD 625.00

5 Days

Rabbit polyclonal antibody to COPD (archain 1)

Applications IF, WB
Reactivities Human (Predicted: Mouse, Chicken, Rat, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 89 and 511 of COPD (Uniprot ID#P48444)
Coatomer subunit delta (ARCN1) Rabbit Polyclonal Antibody
TA335019

USD 539.00

5 Days

Rabbit Polyclonal Anti-ARCN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARCN1 antibody: synthetic peptide directed towards the middle region of human ARCN1. Synthetic peptide located within the following region: GGLQNMELHGMIMLRISDDKYGRIRLHVENEDKKGVQLQTHPNVDKKLFT