Rabbit polyclonal anti-MT-ND5 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MT-ND5. |
Rabbit polyclonal anti-MT-ND5 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MT-ND5. |
Rabbit Polyclonal Anti-ND5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ND5 antibody: synthetic peptide directed towards the N terminal of human ND5. Synthetic peptide located within the following region: SIVASTFIISLFPTTMFMCLDQEVIISNWHWATTQTTQLSLSFKLDYFSM |