Goat Anti-Adenosine A2b Receptor Antibody
Applications | FC, IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CQADVKSGNGQ, from the C Terminus of the protein sequence according to NP_000667.1. |
Goat Anti-Adenosine A2b Receptor Antibody
Applications | FC, IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CQADVKSGNGQ, from the C Terminus of the protein sequence according to NP_000667.1. |
Rabbit Polyclonal Anti-ADORA2B Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ADORA2B antibody was raised against a 19 amino acid peptide near the carboxy terminus of human ADORA2B. The immunogen is located within the last 50 amino acids of ADORA2B. |
Rabbit Polyclonal Anti-ADORA2B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ADORA2B antibody: synthetic peptide directed towards the C terminal of human ADORA2B. Synthetic peptide located within the following region: AKSLAMIVGIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHAN |