Rabbit polyclonal anti-HSD11B1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human HSD11B1. |
Rabbit polyclonal anti-HSD11B1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human HSD11B1. |
Rabbit Polyclonal Anti-HSD11B1 Antibody
Applications | IHC, WB |
Reactivities | Rat, Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HSD11B1 antibody: synthetic peptide directed towards the N terminal of human HSD11B1. Synthetic peptide located within the following region: QKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHI |