Germany
Japan
United Kingdom
China
ISL1 mouse monoclonal antibody, clone OTI2D8 (formerly 2D8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Carrier-free (BSA/glycerol-free) ISL1 mouse monoclonal antibody, clone OTI2D8 (formerly 2D8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ISL1 mouse monoclonal antibody,clone OTI6E8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ISL1 mouse monoclonal antibody,clone OTI6E8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 509.00
2 Weeks
ISL1 mouse monoclonal antibody,clone OTI6E8, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 509.00
2 Weeks
ISL1 mouse monoclonal antibody,clone OTI6E8, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
USD 509.00
2 Weeks
ISL1 mouse monoclonal antibody, clone OTI2D8 (formerly 2D8), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 509.00
2 Weeks
ISL1 mouse monoclonal antibody, clone OTI2D8 (formerly 2D8), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
ISL1 mouse monoclonal antibody,clone OTI6E8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal anti-ISL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ISL1 antibody is: synthetic peptide directed towards the C-terminal region of Human ISL1. Synthetic peptide located within the following region: IMMKQLQQQQPNDKTNIQGMTGTPMVAASPERHDGGLQANPVEVQSYQPP |
Rabbit Polyclonal Anti-ISL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ISL1 antibody: synthetic peptide directed towards the N terminal of human ISL1. Synthetic peptide located within the following region: IECFRCVACSRQLIPGDEFALREDGLFCRADHDVVERASLGAGDPLSPLH |
ISL1 mouse monoclonal antibody, clone OTI2D8 (formerly 2D8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- ISLET 1
Families
- Transcription Factors