SPI1 mouse monoclonal antibody,clone OTI1F3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SPI1 mouse monoclonal antibody,clone OTI1F3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SPI1 mouse monoclonal antibody,clone OTI1F3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SPI1 mouse monoclonal antibody,clone OTI1F3, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
SPI1 mouse monoclonal antibody,clone OTI1F3, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Rabbit polyclonal SPI1 Antibody (C-term)
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Mouse, Rat, Pig) |
Conjugation | Unconjugated |
Immunogen | This SPI1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 217-246 amino acids from the C-terminal region of human SPI1. |
Goat Polyclonal Antibody against SPI1
Applications | IHC, WB |
Reactivities | Human (Expected from sequence similarity: Rat) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DLYQRQTHEYY, from the internal region of the protein sequence according to NP_001074016.1; NP_003111.2. |
SPI1 (27-37) goat polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Bovine, Canine, Equine, Porcine, Rabbit |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide from an internal region of human SPI1 / PU.1 (NP_001074016.1; NP_003111.2) |
Rabbit polyclonal SPI1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | he antiserum was produced against synthesized peptide derived from internal of human SPI1. |
Rabbit Monoclonal PU.1 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal anti-SPI1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SPI1 antibody is: synthetic peptide directed towards the N-terminal region of Human SPI1. Synthetic peptide located within the following region: MEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPH |
Rabbit Polyclonal anti-SPI1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SPI1 antibody: synthetic peptide directed towards the middle region of human SPI1. Synthetic peptide located within the following region: HPSLGHQVSYLPRMCLQYPSLSPAQPSSDEEEGERQSPPLEVSDGEADGL |
Rabbit Polyclonal Anti-SPI1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SPI1 Antibody: synthetic peptide directed towards the middle region of human SPI1. Synthetic peptide located within the following region: QKGNRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGGLAER |
SPI1 mouse monoclonal antibody,clone OTI1F3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |