Antibodies

View as table Download

NR0B1 mouse monoclonal antibody, clone OTI5F5 (formerly 5F5)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NR0B1 mouse monoclonal antibody, clone OTI5F5 (formerly 5F5)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal antibody to NR0B1 (nuclear receptor subfamily 0, group B, member 1)

Applications IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 96 and 406 of NR0B1 (Uniprot ID#P51843)

Rabbit anti-NR0B1 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human NR0B1

Rabbit Polyclonal anti-NR0B1 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR0B1 antibody: synthetic peptide directed towards the middle region of human NR0B1. Synthetic peptide located within the following region: QAIKCFLSKCWSLNISTKEYAYLKGTVLFNPDVPGLQCVKYIQGLQWGTQ

Rabbit Polyclonal Anti-NR0B1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR0B1 antibody: synthetic peptide directed towards the N terminal of human NR0B1. Synthetic peptide located within the following region: TSSKQTHVAPAAPEARPGGAWWDRSYFAQRPGGKEALPGGRATALLYRCC

NR0B1 mouse monoclonal antibody, clone OTI5F5 (formerly 5F5)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Antibody against NR0B1 (N-term)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This DAX1 (NR0B1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 4-34 amino acids from the N-terminal region of human DAX1 (NR0B1).

Rabbit Polyclonal Antibody against NR0B1 (C-term)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This DAX1 (NR0B1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 304-333 amino acids from the C-terminal region of human DAX1 (NR0B1).

Goat Polyclonal Antibody against NR0B1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CGEDHPQQGSTLY, from the internal region of the protein sequence according to NP_000466.2.

Rabbit Polyclonal Anti-NR0B1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR0B1 antibody: synthetic peptide directed towards the N terminal of human NR0B1. Synthetic peptide located within the following region: MAGENHQWQGSILYNMLMSAKQTRAAPEAPETRLVDQCWGCSCGDEPGVG

Rabbit Polyclonal Anti-NR0B1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR0B1 antibody: synthetic peptide directed towards the middle region of human NR0B1. Synthetic peptide located within the following region: FCGEDHPQQGSTLYCVPTSTNQAQAAPEERPRAPWWDTSSGALRPVALKS