Germany
Japan
United Kingdom
China
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR-2D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Rabbit monoclonal anti-Sox2 Antibody, clone OR-4F2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Goat Anti-GATA3 Antibody
| Applications | IHC, WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence EVTADQPRWVSHH-C, from the N Terminus of the protein sequence according to NP_001002295.1; NP_002042.1. |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR-2D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against SOX2 - Embryonic Stem Cell Marker
| Applications | FC, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Sheep |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human SOX2 protein (within residues 1-100). [Swiss-Prot# P48431] |
Rabbit Polyclonal Antibody against OCT4 - Embryonic Stem Cell Marker
| Applications | FC, ICC/IF, IHC, WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal portion of the human OCT4 protein sequence (between residues 100-200). |
Goat Polyclonal Antibody against DKK1
| Applications | FC, IF, IHC, PEP-ELISA, WB |
| Reactivities | Human (Expected from sequence similarity: Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CDHHQASNSSRLHT, from the C Terminus of the protein sequence according to NP_036374. |
Rabbit polyclonal KLF4 Antibody (N-term C74)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This KLF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 69-101 amino acids from the N-terminal region of human KLF4. |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
WNT3A Rabbit monoclonal antibody,clone OTIR4G6
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-SOX10 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SOX10 Antibody: synthetic peptide directed towards the middle region of human SOX10. Synthetic peptide located within the following region: PGGEAEQGGTAAIQAHYKSAHLDHRHPGEGSPMSDGNPEHPSGQSHGPPT |
Rabbit Polyclonal antibody to CD44 (CD44 molecule (Indian blood group))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 258 of CD44 |
Active filters
Isotypes
- IgG
Families
- Adult stem cells
Filter by
Category
Target Symbol
- EGFR (47)
- CD44 (14)
- HDAC1 (13)
- SOX2 (12)
- ERBB 3 (10)
- OCT4 (10)
- BDNF (9)
- CD117 (9)
- GATA1 (9)
- HNF1 ALPHA (9)
- NOTCH1 (9)
- FGF4 (8)
- GATA3 (8)
- SOX1 (8)
- SOX9 (8)
- KLF4 (7)
- NEUROD1 (7)
- CDX2 (6)
- LEF1 (6)
- MAP2 (6)
- PAX3 (6)
- CD4 (5)
- CD8A (5)
- EGF (5)
- HGF (5)
- REX1 (5)
- WNT3A (5)
- BMP7 (4)
- IGFBP1 (4)
- IGFBP2 (4)
- PAX7 (4)
- PDGFC (4)
- SFRP1 (4)
- WNT1 (4)
- APOLIPOPROTEIN E (3)
- BMP15 (3)
- BMP6 (3)
- CCN4 (3)
- CD14 (3)
- CD9 (3)
- CD97 (3)
- DKK1 (3)
- DKK2 (3)
- LIF (3)
- WNT2 (3)
- WNT6 (3)
- BMP2 (2)
- BMP8B (2)
- CD34 (2)
- DKK4 (2)
- DLL1 (2)
- FGF21 (2)
- GATA2 (2)
- GLI2 (2)
- GLI3 (2)
- KGF (2)
- PAX6 (2)
- TAL1 (2)
- WNT5A (2)
- BMP4 (1)
- BMP5 (1)
- CD72 (1)
- FGF10 (1)
- GDF 5 (1)
- GDF 9 (1)
- GDF3 (1)
- GDF7 (1)
- SFRP4 (1)
- SFRP5 (1)
- SMURF 2 (1)
- SOX10 (1)
- WNT7B (1)
Reactivities
Applications
Antibody Hosts
Clonalities
Conjugates
Modifications
Assay Types
Pathways
- Pathways in cancer (123)
- Cytokine-cytokine receptor interaction (80)
- MAPK signaling pathway (77)
- Endocytosis (74)
- Melanoma (74)
- Regulation of actin cytoskeleton (72)
- ErbB signaling pathway (62)
- Prostate cancer (62)
- Focal adhesion (61)
- Endometrial cancer (58)
- Calcium signaling pathway (57)
- Dorso-ventral axis formation (56)
- Gap junction (56)
- Adherens junction (53)
- Colorectal cancer (53)
- Bladder cancer (52)
- Glioma (52)
- Non-small cell lung cancer (52)
- Pancreatic cancer (52)
- Epithelial cell signaling in Helicobacter pylori infection (47)
- GnRH signaling pathway (47)
- Hematopoietic cell lineage (43)
- Wnt signaling pathway (38)
- Hedgehog signaling pathway (35)
- Melanogenesis (35)
- Basal cell carcinoma (31)
- Notch signaling pathway (24)
- Huntington's disease (22)
- Maturity onset diabetes of the young (18)
- Acute myeloid leukemia (17)
- TGF-beta signaling pathway (16)
- ECM-receptor interaction (14)
- Cell adhesion molecules (CAMs) (13)
- Cell cycle (13)
- Chronic myeloid leukemia (13)
- Antigen processing and presentation (11)
- Primary immunodeficiency (10)
- T cell receptor signaling pathway (10)
- Neurotrophin signaling pathway (9)
- Prion diseases (9)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (6)
- Thyroid cancer (6)
- Renal cell carcinoma (5)
- Alzheimer's disease (3)
- Jak-STAT signaling pathway (3)
- Pathogenic Escherichia coli infection (3)
- Toll-like receptor signaling pathway (3)
- Allograft rejection (1)
- Autoimmune thyroid disease (1)
- B cell receptor signaling pathway (1)
- Graft-versus-host disease (1)
- Type I diabetes mellitus (1)
- Ubiquitin mediated proteolysis (1)
- Viral myocarditis (1)