Antibodies

Jump to Filters
View as table Download
FGF16 Rabbit Polyclonal Antibody
TA351187

USD 380.00

In Stock

Rabbit Polyclonal Anti-FGF16 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human FGF16
FGF16 Rabbit Polyclonal Antibody
TA367054

USD 380.00

4 Weeks

FGF16 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human FGF16
FGF16 Rabbit Polyclonal Antibody
TA384219

USD 380.00

4 Weeks

FGF16 Rabbit polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from the Internal region of human FGF16. AA range:141-190
FGF16 (N-term) Rabbit Polyclonal Antibody
AP51654PU-N

USD 580.00

2 Weeks

FGF16 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 29-58 amino acids from the N-terminal region of human FGF16
FGF16 Goat Polyclonal Antibody
PP1103P2

USD 465.00

2 Weeks

FGF16 goat polyclonal antibody, Aff - Purified

Applications ELISA, FN, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Highly pure (>98%) recombinant hFGF-16 (human Fibroblast Growth Factor-16).
FGF16 Rabbit Polyclonal Antibody
TA338201

USD 539.00

5 Days

Rabbit Polyclonal Anti-FGF16 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FGF16 antibody is: synthetic peptide directed towards the C-terminal region of Human FGF16. Synthetic peptide located within the following region: REQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTH
FGF16 Goat Polyclonal Antibody
PP1103P1

USD 345.00

2 Weeks

FGF16 goat polyclonal antibody, Aff - Purified

Applications ELISA, FN, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Highly pure (>98%) recombinant hFGF-16 (human Fibroblast Growth Factor-16).