Rabbit Polyclonal Anti-CRLF2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CRLF2 |
Rabbit Polyclonal Anti-CRLF2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CRLF2 |
Mouse Polyclonal TSLP R/CRLF2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Amino acids 119-231 of human TSLPR protein were used as the immunogen for the antibody. |
Mouse Polyclonal TSLP R/CRLF2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Amino acids 119-231 of human TSLPR protein were used as the immunogen for the antibody. |
Mouse Monoclonal TSLP R/CRLF2 Antibody (59N5G4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CRLF2 mouse monoclonal antibody, clone AT4E7, Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CRLF2 mouse monoclonal antibody, clone AT4E7, Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CRLF2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CRLF2 Antibody: synthetic peptide directed towards the middle region of human CRLF2. Synthetic peptide located within the following region: FWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSKF |