Antibodies

Jump to Filters
View as table Download
NR1D1 Rabbit Polyclonal Antibody
TA392606

USD 325.00

3 Weeks

Rev-Erbα polyclonal antibody

Applications WB
Reactivities Human, Pig
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to Human Rev-Erbα.
PXR (NR1I2) Rabbit Polyclonal Antibody
TA392607

USD 325.00

3 Weeks

PXR polyclonal antibody

Applications WB
Reactivities Human, Pig
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to Human PXR.
CXADR Rabbit Polyclonal Antibody
TA392610

USD 325.00

3 Weeks

CAR polyclonal antibody

Applications WB
Reactivities Human, Pig
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to Human CAR.
Porcine IgG (H+L chain) Rabbit Polyclonal Antibody
R1384HRP

USD 355.00

3 Days

Porcine IgG (H+L chain) rabbit polyclonal antibody, HRP

Applications Suitable for Immunoblotting (Western or dot blot), ELISA, Immunoperoxidase electron microscopy and Immunohistochemistry as well as other peroxidase-antibody based enzymatic assays requiring lot-to-lot consistency.
Recommended Dilutions:
ELISA: 1/150,000.
Western blot: 1/1,000-1/5,000.
Immunohistochemistry: 1/500-1/2,500.
Reactivities Pig
Conjugation HRP
Immunogen Swine IgG whole molecule
RAB4B Rabbit Polyclonal Antibody
TA342685

USD 539.00

5 Days

Rabbit Polyclonal Anti-RAB4B Antibody

Reactivities Human, Mouse, Pig, Dog, Horse, Zebrafish, Brugia malayi
Conjugation Unconjugated
Immunogen The immunogen for anti-RAB4B antibody is: synthetic peptide directed towards the middle region of Human RAB4B. Synthetic peptide located within the following region: SPNIVVILCGNKKDLDPEREVTFLEASRFAQENELMFLETSALTGENVEE
Porcine IgG F(ab)2 specific Rabbit Polyclonal Antibody
R1386P

USD 415.00

3 Days

Porcine IgG F(ab)2 specific rabbit polyclonal antibody, Aff - Purified

Applications Suitable for Immunoprecipitation, Immunodiffusion, conjugation and most immunological methods requiring lot-to-lot consistency, high titer and specificity.
Reactivities Pig
Conjugation Unconjugated
Immunogen Swine IgG F(ab')2 fragment.
FBXO43 Goat Polyclonal Antibody
TA305817

USD 520.00

5 Days

Goat Anti-EMI2 Antibody

Reactivities Mouse, Rat (Expected from sequence similarity: Human, Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-PGSAQSKRNLKRL, from the C Terminus of the protein sequence according to NP_001070996.1; NP_001025031.2.
ROR alpha (RORA) Rabbit Polyclonal Antibody
TA392600

USD 325.00

3 Weeks

RORA polyclonal antibody

Applications WB
Reactivities Pig
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to Human RORA.
NR2C2 Rabbit Polyclonal Antibody
TA392601

USD 325.00

3 Weeks

TR4 polyclonal antibody

Applications WB
Reactivities Human, Pig
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to Human TR4.
NR2F6 Rabbit Polyclonal Antibody
TA392603

USD 325.00

3 Weeks

EAR2 polyclonal antibody

Applications WB
Reactivities Pig
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to Human EAR2.
Integrin alpha 6 (ITGA6) Polyclonal Antibody [Clone ID: GoH3]
TA398694

USD 365.00

2 Weeks

Anti-Hu CD49f APC

Applications FC
Reactivities Non-human primates, Horse, Pig, Rabbit, Cow, Dog, Feline, Human, Sheep, Mouse
Conjugation Unconjugated
Immunogen mouse mammary tumor cells
Porcine IgG (H+L chain) Rabbit Polyclonal Antibody
R1384AP

USD 385.00

3 Days

Porcine IgG (H+L chain) rabbit polyclonal antibody, AP

Applications Suitable for Immunoblotting (Western or Dot blot), ELISA and Immunohistochemistry as well as other phosphatase-antibody based enzymatic assays requiring lot-to-lot consistency.
Recommended Dilutions: This product has been assayed against 1.0 µg of Swine IgG in a standard capture ELISA using pNPP p-nitrophenyl phosphate as a substrate for 30 minutes at room temperature. A working dilution of 1:500 to 1:4,000 of the reconstitution concentration is suggested for this product.
Reactivities Pig
Conjugation AP
Immunogen Swine IgG whole molecule
Porcine IgG (H+L chain) Rabbit Polyclonal Antibody
R1384B

USD 335.00

3 Days

Porcine IgG (H+L chain) rabbit polyclonal antibody, Biotin

Applications Suitable for Immunoblotting, ELISA, Immunohistochemistry, Immunomicroscopy as well as other antibody based assays using streptavidin or avidin conjugates requiring lot-to-lot consistency.
Recommended Dilutions: This product has been assayed against 1.0 µg of Swine IgG in a standard capture ELISA using Peroxidase conjugated Streptavidin and ABTS (2,2'-azino-bis-[3-ethylbenthiazoline-6- sulfonic acid]) as a substrate for 30 minutes at room temperature. A working dilution of 1:20,000 to 1:100,000 of the reconstitution concentration is suggested for this product.
Reactivities Pig
Conjugation Biotin
Immunogen Swine IgG whole molecule.
Porcine IgG (H+L chain) Rabbit Polyclonal Antibody
R1384F

USD 310.00

3 Days

Porcine IgG (H+L chain) rabbit polyclonal antibody, FITC

Applications Suitable for Immunomicroscopy and Flow cytometry or FACS analysis as well as other antibody based fluorescent assays requiring lot-to-lot consistency.
Reactivities Pig
Conjugation FITC
Immunogen Swine IgG whole molecule.
Porcine IgG (H+L chain) Rabbit Polyclonal Antibody
R1384P

USD 765.00

3 Days

Porcine IgG (H+L chain) rabbit polyclonal antibody, Aff - Purified

Applications Suitable for Immunoprecipitation, Immunodiffusion, conjugation and most immunological methods requiring lot-to-lot consistency, high titer and specificity.
Recommended Dilutions:
ELISA: 1:20,000-1:100,000.
Western Blot: 1:2,000-1:10,000.
Immunohistochemistry: 1:1,000-1:5,000.
Reactivities Pig
Conjugation Unconjugated
Immunogen Swine IgG whole molecule