Rabbit Polyclonal Anti-APMAP Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human APMAP |
Rabbit Polyclonal Anti-APMAP Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human APMAP |
Rabbit Polyclonal Anti-APMAP Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-APMAP antibody: synthetic peptide directed towards the N terminal of human APMAP. Synthetic peptide located within the following region: EPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGRVVK |
Rabbit Polyclonal Anti-APMAP Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-APMAP antibody: synthetic peptide directed towards the C terminal of human APMAP. Synthetic peptide located within the following region: QETVMKFVPRYSLVLELSDSGAFRRSLHDPDGLVATYISEVHEHDGHLYL |