Rabbit Polyclonal Anti-FUT8 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human FUT8 |
Rabbit Polyclonal Anti-FUT8 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human FUT8 |
Rabbit Polyclonal Anti-RPN1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human RPN1 |
Rabbit polyclonal anti-B4GALT3 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human B4GALT3. |
Rabbit polyclonal antibody to alpha Glucosidase II (glucosidase, alpha; neutral AB)
Applications | IHC, WB |
Reactivities | Human (Predicted: Mouse, Monkey, Pig, Rat, Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 654 and 944 of alpha Glucosidase II (Uniprot ID#Q14697) |
Rabbit polyclonal anti-TUSC3 antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TUSC3. |
Goat Polyclonal Antibody against TUSC3
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence PQRQCSVCRQAN, from the internal region of the protein sequence according to NP_006756.2; NP_839952.1. |
Rabbit Polyclonal Anti-ALG6 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ALG6 |
Goat Anti-MGAT1 Antibody
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QVEKVRTNDR, from the internal region of the protein sequence according to NP_002397.2. |
Rabbit Polyclonal Anti-Alg8 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Alg8 Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: LELKLLDPSQIPRASMTSGLVQQSQHTVLPSVSPSATLICTLIAILPSVF |
Rabbit Polyclonal Anti-TUSC3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TUSC3 Antibody: A synthesized peptide derived from human TUSC3 |