Antibodies

View as table Download

Rabbit polyclonal anti-SMAD1 antibody

Applications WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a phosphorylated synthetic peptide corresponding to the region of amino acids containing serine 206 of human SMAD1 protein.

Rabbit polyclonal SMAD1 phospho S206 antibody

Applications WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a phosphorylated synthetic peptide corresponding to the region of amino acids containing serine 206 of human SMAD1 protein.

Rabbit Polyclonal erk1/2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human ERK1/2.

SMAD1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SMAD1

Rabbit Polyclonal SMAD1/5/8/9 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This antibody was developed against two synthetic peptides corresponding to amino acids 19-33 (GWKQGDEEEKWAEKA) and amino acids 315-329 (SNVNRNSTIENTRRH) of human SMAD1.

Rabbit Polyclonal SMAD1/5/8/9 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This antibody was raised against two synthetic peptides corresponding to amino acids 18-32 (LGWKQGDEEEKWAEK) and amino acids 315-329 (SNVNRNSTIENTRRH) of human SMAD1. GenBank Accession No. AAP36050.1. They are 100% conserved or highly conserved between

Rabbit Polyclonal Anti-BMP6 Antibody - middle region

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-BMP6 antibody: synthetic peptide directed towards the middle region of human BMP6. Synthetic peptide located within the following region: MVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSEL

Rabbit Polyclonal Anti-Smad1/5/9 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Smad1/5/9 Antibody: A synthesized peptide derived from human Smad1/5/9

Rabbit Polyclonal Anti-TGF beta1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-TGF beta1 Antibody: The antiserum was produced against synthesized peptide derived from human TGF beta.

Rabbit polyclonal anti-BMP2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human BMP2

Rabbit polyclonal Smad3 (Ser204) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Smad3 around the phosphorylation site of serine 204 (A-G-SP-P-N).
Modifications Phospho-specific

Rabbit anti ERK1 Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit anti TGF beta Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide derived from C-terminus of human TGF-beta protein.