Antibodies

Jump to Filters
View as table Download
BCL2A1 Rabbit Polyclonal Antibody
TA306339

USD 570.00

5 Days

Rabbit Polyclonal Bfl-1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Bfl-1 antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human Bfl-1.
BCL2A1 Rabbit Polyclonal Antibody
TA330408

USD 539.00

5 Days

Rabbit Polyclonal Anti-BCL2A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BCL2A1 antibody: synthetic peptide directed towards the C terminal of human BCL2A1. Synthetic peptide located within the following region: FIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQY