Antibodies

View as table Download

Rabbit Polyclonal Anti-SHH Antibody

Applications IHC, WB
Reactivities Human, Mouse, Chicken
Conjugation Unconjugated
Immunogen The immunogen for anti-SHH antibody: synthetic peptide directed towards the N terminal of human SHH. Synthetic peptide located within the following region: RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT

Caspase 3 (CASP3) (full length) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Bovine, Canine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Yeast
Conjugation Unconjugated
Immunogen Recombinant human Caspase-3 protein (full length)

beta Catenin (CTNNB1) mouse monoclonal antibody, clone IMD-110, Purified

Applications IF, IHC, WB
Reactivities Chicken, Human, Rat
Conjugation Unconjugated