Antibodies

Jump to Filters
View as table Download
FGF2 Rabbit Polyclonal Antibody
TA890058

USD 407.00

In Stock

Rabbit polyclonal anti-FGF2 Antibody

Applications WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human FGF2
WNT2 Rabbit Polyclonal Antibody
TA329906

USD 539.00

5 Days

Rabbit Polyclonal Anti-WNT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT2 antibody: synthetic peptide directed towards the middle region of human WNT2. Synthetic peptide located within the following region: GSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKERKGKDARALMNLHNNR
TGF beta 1 (TGFB1) Rabbit Polyclonal Antibody
TA347822

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-TGF beta1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-TGF beta1 Antibody: The antiserum was produced against synthesized peptide derived from human TGF beta.
IGF1 Rabbit Polyclonal Antibody
TA348004

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-IGF1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-IGF1 antibody: A synthesized peptide derived from human IGF1