Mouse monoclonal anti-ACTB(beta Actin) antibody, Loading control
Applications | WB |
Reactivities | Human, Mouse, Rat, Monkey, Dog |
Conjugation | Unconjugated |
Mouse monoclonal anti-ACTB(beta Actin) antibody, Loading control
Applications | WB |
Reactivities | Human, Mouse, Rat, Monkey, Dog |
Conjugation | Unconjugated |
Goat Polyclonal Anti-GAPDH Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat, Zebrafish |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli. |
Goat Polyclonal Anti-beta-Actin Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 100 aa to the N-terminus of human beta-Actin produced in E. coli. |
Rabbit polyclonal anti-GAPDH antibody, Loading control
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide conjugated to KLH derived from within residues 220 - 290 of Human GAPDH. |
Goat Anti-GATA3 Antibody
Applications | IHC, WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence EVTADQPRWVSHH-C, from the N Terminus of the protein sequence according to NP_001002295.1; NP_002042.1. |
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
Goat Polyclonal Anti-GAPDH Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli. |
Rabbit Polyclonal Antibody against GLUT1
Applications | ChIP, FC, ICC/IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an N-terminal region of the human GLUT1 protein (between residues 1-100). [Swiss-Prot #P11166] |
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse (Predicted: Feline, Chicken, Dog, Drosophila, Monkey, Pig, Rabbit, Xenopus, Zebrafish, Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
USD 539.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit polyclonal anti-GAPDH antibody, Loading control
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide conjugated to KLH derived from within residues 220 - 290 of Human GAPDH. |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Goat Polyclonal Anti-GAPDH Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat, Zebrafish |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli. |
Rabbit Polyclonal Anti-CD81 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
Anti-ABCG2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 609-621 amino acids of Human ATP-binding cassette sub-family G member 2 |
Rabbit polyclonal PECAM-1 (Ab-713) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |