Rabbit Polyclonal Anti-MYLK3 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MYLK3 |
Rabbit Polyclonal Anti-MYLK3 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MYLK3 |
MYLK3 (N-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the N-terminal region of human MLCK. |
MYLK3 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the central region (between 542-570aa) of human MLCK / MYLK3 |
Rabbit Polyclonal Anti-MYLK3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MYLK3 Antibody is: synthetic peptide directed towards the C-terminal region of Human MYLK3. Synthetic peptide located within the following region: LVKEKSCRMSATQCLKHEWLNNLPAKASRSKTRLKSQLLLQKYIAQRKWK |