Anti-HK2 (Hexokinase II) mouse monoclonal antibody, clone OTI4C5 (formerly 4C5)
Applications | FC, IF, WB |
Reactivities | Human, Dog, Mouse, Rat |
Conjugation | Unconjugated |
Anti-HK2 (Hexokinase II) mouse monoclonal antibody, clone OTI4C5 (formerly 4C5)
Applications | FC, IF, WB |
Reactivities | Human, Dog, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HK2 mouse monoclonal antibody, clone OTI4C5 (formerly 4C5)
Applications | FC, IF, WB |
Reactivities | Human, Dog, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
Anti-HK2 (Hexokinase II) mouse monoclonal antibody, clone OTI4C5 (formerly 4C5), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human, Dog, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
Anti-HK2 (Hexokinase II) mouse monoclonal antibody, clone OTI4C5 (formerly 4C5), HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human, Dog, Mouse, Rat |
Conjugation | HRP |
USD 224.00
USD 447.00
In Stock
Anti-HK2 (Hexokinase II) mouse monoclonal antibody, clone OTI4D4 (formerly 4D4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HK2 mouse monoclonal antibody, clone OTI4D4 (formerly 4D4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-HK2 (Hexokinase II) mouse monoclonal antibody, clone OTI4C5 (formerly 4C5)
Applications | FC, IF, WB |
Reactivities | Human, Dog, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal HK2 (Hexokinase II) Antibody (Center)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This HK2 (Hexokinase II) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 453-483 amino acids from the Central region of human HK2 (Hexokinase II). |
Rabbit Polyclonal Anti-HK2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human HK2 |
USD 509.00
2 Weeks
Anti-HK2 (Hexokinase II) mouse monoclonal antibody, clone OTI4D4 (formerly 4D4), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
Anti-HK2 (Hexokinase II) mouse monoclonal antibody, clone OTI4D4 (formerly 4D4), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Rabbit Polyclonal Anti-HK2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-HK2 Antibody: synthetic peptide directed towards the N terminal of human HK2. Synthetic peptide located within the following region: GTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMRGSG |
Rabbit polyclonal HK2 (Hexokinase II) Antibody (N-term)
Applications | IHC, WB |
Reactivities | Human (Predicted: Mouse, Rat, Pig) |
Conjugation | Unconjugated |
Immunogen | This HK2 (Hexokinase II) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 91-121 amino acids from the N-terminal region of human HK2 (Hexokinase II). |
Rabbit Polyclonal Anti-HK2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-HK2 Antibody: synthetic peptide directed towards the middle region of human HK2. Synthetic peptide located within the following region: QRIKENKGEERLRSTIGVDGSVYKKHPHFAKRLHKTVRRLVPGCDVRFLR |
Rabbit anti-HK2 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HK2 |