beta Sarcoglycan (SGCB) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
beta Sarcoglycan (SGCB) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-SGCB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SGCB antibody: synthetic peptide directed towards the middle region of human SGCB. Synthetic peptide located within the following region: FSTDYETHEFHLPSGVKSLNVQKASTERITSNATSDLNIKVDGRAIVRGN |
Rabbit Polyclonal Anti-SGCB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SGCB antibody is: synthetic peptide directed towards the middle region of Human SGCB. Synthetic peptide located within the following region: RIGPNGCDSMELHESGLLRFKQVSDMGVIHPLYKSTVGGRRNENLVITGN |