Rabbit Polyclonal Anti-ABCC9 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ABCC9 |
Rabbit Polyclonal Anti-ABCC9 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ABCC9 |
Rabbit Polyclonal Anti-ABCC9 Antibody
Applications | WB |
Reactivities | Mouse, Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ABCC9 Antibody: synthetic peptide directed towards the middle region of human ABCC9. Synthetic peptide located within the following region: AVVTEGGENFSVGQRQLFCLARAFVRKSSILIMDEATASIDMATENILQK |