Anti-ADAM12 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 223-239 amino acids of human ADAM metallopeptidase domain 12 |
Anti-ADAM12 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 223-239 amino acids of human ADAM metallopeptidase domain 12 |
Goat Polyclonal Antibody against ADAM12
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence AARPLPVSPARALC, from the N Terminus of the protein sequence according to NP_003465; NP_067673. |
Goat Anti-ADAM12 (aa225-239) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Pig, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-REFQRQGKDLEKVKQ, from the internal region of the protein sequence according to NP_003465.3; NP_067673.2. |
Rabbit Polyclonal Anti-ADAM12 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ADAM12 antibody: synthetic peptide directed towards the N terminal of human ADAM12. Synthetic peptide located within the following region: VELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVE |