Sphingomyelin Synthase 2 (SGMS2) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from the Human Sphingomyelin Synthase 2 protein |
Sphingomyelin Synthase 2 (SGMS2) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from the Human Sphingomyelin Synthase 2 protein |
Sphingomyelin Synthase 2 (SGMS2) rabbit polyclonal antibody, Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from the human sphingomyelin synthase 2 protein. |
Rabbit Polyclonal Anti-SGMS2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SGMS2 antibody: synthetic peptide directed towards the N terminal of human SGMS2. Synthetic peptide located within the following region: KFPLEWWKTGIAFIYAVFNLVLTTVMITVVHERVPPKELSPPLPDKFFDY |
Sphingomyelin Synthase 2 (SGMS2) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of Human SGMS2. |
Rabbit Polyclonal Anti-SGMS2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SGMS2 antibody: synthetic peptide directed towards the N terminal of human SGMS2. Synthetic peptide located within the following region: KFPLEWWKTGIAFIYAVFNLVLTTVMITVVHERVPPKELSPPLPDKFFDY |