Antibodies

Jump to Filters
View as table Download
SENP1 Rabbit Polyclonal Antibody
TA350938

USD 380.00

In Stock

Rabbit Polyclonal Anti-SENP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SENP1
SENP1 Rabbit Polyclonal Antibody
TA351648

USD 380.00

In Stock

Rabbit Polyclonal Anti-SENP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SENP1
SENP1 Rabbit Polyclonal Antibody
TA312368

USD 380.00

In Stock

Rabbit polyclonal anti-SENP1 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human SENP1.
SENP1 Rabbit Polyclonal Antibody
TA334552

USD 539.00

5 Days

Rabbit Polyclonal Anti-SENP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SENP1 antibody: synthetic peptide directed towards the middle region of human SENP1. Synthetic peptide located within the following region: PQQMNGSDCGMFACKYADCITKDRPINFTQQHMPYFRKRMVWEILHRKLL