Rabbit Polyclonal Anti-KLK6 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human KLK6 |
Rabbit Polyclonal Anti-KLK6 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human KLK6 |
Rabbit polyclonal Kallikrein 6 Antibody (N-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This Kallikrein 6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human Kallikrein 6. |
Rabbit polyclonal Kallikrein 6 Antibody (Center)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This Kallikrein 6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 126-156 amino acids from the Central region of human Kallikrein 6. |
Rabbit Polyclonal Anti-KLK6 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KLK6 antibody: synthetic peptide directed towards the N terminal of human KLK6. Synthetic peptide located within the following region: KHNLRQRESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQ |