Rabbit Polyclonal Anti-Ppp3cb Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ppp3cb antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRI |
Rabbit Polyclonal Anti-Ppp3cb Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Ppp3cb antibody is: synthetic peptide directed towards the middle region of Rat Ppp3cb. Synthetic peptide located within the following region: MCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLS |
Rabbit Polyclonal Anti-PPP2R1A Antibody - middle region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP2R1A antibody: synthetic peptide directed towards the middle region of human PPP2R1A. Synthetic peptide located within the following region: NVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSL |
Rabbit Polyclonal Anti-PPP2R5E Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP2R5E antibody: synthetic peptide directed towards the N terminal of human PPP2R5E. Synthetic peptide located within the following region: QFRSQGKPIELTPLPLLKDVPSSEQPELFLKKLQQCCVIFDFMDTLSDLK |
PPP2R1A rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A peptide conjugated to KLH |
PP2A-alpha (PPP2CA) sheep polyclonal antibody, Purified
| Applications | IP, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A peptide conjugated to KLH |
Calcineurin A (PPP3CA) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A peptide conjugated to KLH |
Calcineurin A (PPP3CA) sheep polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A purified peptide conjugated to KLH |
PPP3CA Rabbit Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PPP3CA |
PPP2R5D rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide conjugated to KLH derived from the N-terminus of PP2A/B delta |
PP2A-alpha (PPP2CA) sheep polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is the purified peptide conjugated to KLH. |
Germany
Japan
United Kingdom
China